General Information

  • ID:  hor002884
  • Uniprot ID:  P17681
  • Protein name:  Peptide 2
  • Gene name:  NA
  • Organism:  Aplysia fasciata (Mottled sea hare) (Aplysia brasiliana)
  • Family:  NA
  • Source:  animal
  • Expression:  Neurons R3-R14. A cluster of 12 giant neurons located on the right side of the abdominal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DAEEPSAFMTRL
  • Length:  12(29-40)
  • Propeptide:  EEVFDDTDVGDELTNALESVLTDLKDKRDAEEPSAFMTRLRRQVAQMHIWRAVNHDRHHSTGSGRHSRFLTRNRYRYGGGHLSDA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  HRBP is a myoactive peptide that excites Aplysia heart and enhances gut motility in vitro.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P17681-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002884_AF2.pdbhor002884_ESM.pdb

Physical Information

Mass: 156289 Formula: C58H91N15O21S
Absent amino acids: CGHIKNQVWY Common amino acids: AE
pI: 3.93 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -50 Boman Index: -2936
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 49.17
Instability Index: 6603.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2587425
  • Title:  Aplysia brasiliana neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and its prohormone.